FBXO22 Antibody

Name FBXO22 Antibody
Supplier Novus Biologicals
Catalog NBP1-55425
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to FBXO22(F-box protein 22) The peptide sequence was selected from the middle region of FBXO22. Peptide sequence CCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKYVLCASDFVCE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene FBXO22
Supplier Page Shop

Product images