EFCAB4B Antibody

Name EFCAB4B Antibody
Supplier Novus Biologicals
Catalog NBP1-55340
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to EFCAB4B(EF-hand calcium binding domain 4B) The peptide sequence was selected from the middle region of EFCAB4B. Peptide sequence KNELECALKRKIAAYDEEIQHLYEEMEQQIKSEKEQFLLKDTERFQARSQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CRACR2A
Conjugate Unconjugated
Supplier Page Shop

Product images