Rffl Antibody

Name Rffl Antibody
Supplier Novus Biologicals
Catalog NBP1-55375
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to RFFL (ring finger and FYVE-like domain containing 1) The peptide sequence was selected from the middle region of RFFL)(50ug). Peptide sequence KDQKGLQHLVSGAEDQNGGAVPSGLEENLCKICMDSPIDCVLLECGHMVT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RFFL
Supplier Page Shop

Product images