PPIH Antibody

Name PPIH Antibody
Supplier Novus Biologicals
Catalog NBP1-55448
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to PPIH (peptidylprolyl isomerase H (cyclophilin H)) The peptide sequence was selected from the middle region of PPIH. Peptide sequence DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene PPIH
Supplier Page Shop

Product images