RHBDF1 Antibody
| Name | RHBDF1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59725 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RHBDF1(rhomboid 5 homolog 1 (Drosophila)) The peptide sequence was selected from the N terminal of RHBDF1. Peptide sequence KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RHBDF1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RHBDF1 Antibody [NBP1-59725] - Sample Tissue: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/Lane, Gel Concentration: 0.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7415_RHBDF1-Antibody-Western-Blot-NBP1-59725-img0004.jpg)
Western Blot: RHBDF1 Antibody [NBP1-59725] - Sample Tissue: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide Concentration: 5ug/ml, Lysate Quantity: 25ug/lane/Lane, Gel Concentration: 0.
![Western Blot: RHBDF1 Antibody [NBP1-59725] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7416_RHBDF1-Antibody-Western-Blot-NBP1-59725-img0003.jpg)
Western Blot: RHBDF1 Antibody [NBP1-59725] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.