RNF139 Antibody

Name RNF139 Antibody
Supplier Novus Biologicals
Catalog NBP1-59756
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNF139(ring finger protein 139) The peptide sequence was selected from the N terminal of RNF139. Peptide sequence SQRSLFKFYTYSSAFLLAATSVLVNYYASLHIDFYGAYNTSAFGIELLPR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RNF139
Conjugate Unconjugated
Supplier Page Shop

Product images