DNAJC10 Antibody

Name DNAJC10 Antibody
Supplier Novus Biologicals
Catalog NBP1-59668
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DNAJC10(DnaJ (Hsp40) homolog, subfamily C, member 10) The peptide sequence was selected from the N terminal of DNAJC10. Peptide sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DNAJC10
Conjugate Unconjugated
Supplier Page Shop

Product images