AWAT1 Antibody

Name AWAT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59865
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AWAT1 (acyl-CoA wax alcohol acyltransferase 1) Antibody(against the N terminal of AWAT1. Peptide sequence NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AWAT1
Conjugate Unconjugated
Supplier Page Shop

Product images