Name | TSPAN12 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-91297 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Rat, Pig, Dog, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptide directed towards the middle region of human TSPAN12. Peptide sequence: EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | TSPAN12 |
Supplier Page | Shop |