VTI1A Antibody

Name VTI1A Antibody
Supplier Novus Biologicals
Catalog NBP1-91431
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human VTI1A. Peptide sequence SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene VTI1A
Conjugate Unconjugated
Supplier Page Shop

Product images