Rap2A Antibody

Name Rap2A Antibody
Supplier Novus Biologicals
Catalog NBP1-98405
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for this antibody is RAP2A - C-terminal region. Peptide sequence QIIRVKRYEKVPVILVGNKVDLESEREVSSSEGRALAEEWGCPFMETSAK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RAP2A
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.