Ephrin-A5 Antibody (1F12)
| Name | Ephrin-A5 Antibody (1F12) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001946-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1F12 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | EFNA5 (NP_001953 114 a.a. - 203 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | EFNA5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Ephrin-A5 Antibody (1F12) [H00001946-M01] - EFNA5 monoclonal antibody (M01), clone 1F12. Analysis of EFNA5 expression in IMR-32.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2293_Ephrin-A5%2520Antibody%2520(1F12)-Western%2520Blot-H00001946-M01-img0005.jpg)
Western Blot: Ephrin-A5 Antibody (1F12) [H00001946-M01] - EFNA5 monoclonal antibody (M01), clone 1F12. Analysis of EFNA5 expression in IMR-32.
![Western Blot: Ephrin-A5 Antibody (1F12) [H00001946-M01] - analysis of EFNA5 expression in NIH/3T3 ( Cat # L018V1 ).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2294_Ephrin-A5-Antibody-(1F12)-Western-Blot-H00001946-M01-img0001.jpg)
Western Blot: Ephrin-A5 Antibody (1F12) [H00001946-M01] - analysis of EFNA5 expression in NIH/3T3 ( Cat # L018V1 ).
![ELISA: Ephrin-A5 Antibody (1F12) [H00001946-M01] - Detection limit for recombinant GST tagged EFNA5 is approximately 0.03ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/2295_Ephrin-A5-Antibody-(1F12)-ELISA-H00001946-M01-img0006.jpg)
ELISA: Ephrin-A5 Antibody (1F12) [H00001946-M01] - Detection limit for recombinant GST tagged EFNA5 is approximately 0.03ng/ml as a capture antibody.