CAPZB Antibody (1H1)
| Name | CAPZB Antibody (1H1) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00000832-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1H1 |
| Applications | WB ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | CAPZB (NP_004921 192 a.a. - 272 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CAPZB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CAPZB Antibody (1H1) [H00000832-M02] - CAPZB monoclonal antibody (M02), clone 1H1. Analysis of CAPZB expression in HeLa.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/28808_CAPZB%2520Antibody%2520(1H1)-Western%2520Blot-H00000832-M02-img0006.jpg)
Western Blot: CAPZB Antibody (1H1) [H00000832-M02] - CAPZB monoclonal antibody (M02), clone 1H1. Analysis of CAPZB expression in HeLa.
![Immunohistochemistry-Paraffin: CAPZB Antibody (1H1) [H00000832-M02] - Analysis of monoclonal antibody to CAPZB on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/28809_CAPZB-Antibody-(1H1)-Immunohistochemistry-Paraffin-H00000832-M02-img0004.jpg)
Immunohistochemistry-Paraffin: CAPZB Antibody (1H1) [H00000832-M02] - Analysis of monoclonal antibody to CAPZB on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 1.5 ug/ml.
![Sandwich ELISA: CAPZB Antibody (1H1) [H00000832-M02] - Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/28810_CAPZB-Antibody-(1H1)-Sandwich-ELISA-H00000832-M02-img0005.jpg)
Sandwich ELISA: CAPZB Antibody (1H1) [H00000832-M02] - Detection limit for recombinant GST tagged CAPZB is approximately 0.1ng/ml as a capture antibody.