SLC1A5 Antibody
| Name | SLC1A5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-89327 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:VDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SLC1A5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SLC1A5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: SLC1A5 Antibody [NBP1-89327] - Staining of human cell line A-431 shows localization to plasma membrane.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21118_SLC1A5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89327-img0005.jpg)
![Immunohistochemistry-Paraffin: SLC1A5 Antibody [NBP1-89327] - Staining of human kidney shows strong luminal membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_7/21119_SLC1A5-Antibody-Immunohistochemistry-Paraffin-NBP1-89327-img0004.jpg)