ALKBH8 Antibody
| Name | ALKBH8 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38928 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HTLLRHEGIETVSYATQSLVVANGGLGNGVSRNQLLPVLEKCGLVDALLMPPNKPYSFARYRTTEESKRAYVTLNGKEVV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ALKBH8 Protein |
| Description | Rabbit Polyclonal |
| Gene | ALKBH8 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: ALKBH8 Antibody [NBP2-38928] - Staining of human cell line U-2 OS shows positivity in nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10349_ALKBH8-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38928-img0001.jpg)
![Immunohistochemistry-Paraffin: ALKBH8 Antibody [NBP2-38928] - Staining of human lymph node shows cytoplasmic positivity in germinal center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10350_ALKBH8%2520Antibody-Immunohistochemistry-Paraffin-NBP2-38928-img0004.jpg)