Kv7.2 Antibody
| Name | Kv7.2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38820 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: RLGKVEKQVLSMEKKLDFLVNIYMQRMGIPPTETEAYFGAKEPEPAPPYHSPEDSREHVDRHGCIVKIVRSSSST |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Kv7.2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KCNQ2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: Kv7.2 Antibody [NBP2-38820] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6283_Kv7.2%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38820-img0003.jpg)
Immunocytochemistry/Immunofluorescence: Kv7.2 Antibody [NBP2-38820] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to endoplasmic reticulum.
![Immunohistochemistry: Kv7.2 Antibody [NBP2-38820] - Staining of human hippocampus shows distinct nuclear positivity in glial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6284_Kv7.2-Antibody-Immunohistochemistry-NBP2-38820-img0002.jpg)
Immunohistochemistry: Kv7.2 Antibody [NBP2-38820] - Staining of human hippocampus shows distinct nuclear positivity in glial cells.