ASRGL1 Antibody
| Name | ASRGL1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38759 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: ARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ASRGL1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ASRGL1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ASRGL1 Antibody [NBP2-38759] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6247_ASRGL1%2520Antibody-Western%2520Blot-NBP2-38759-img0002.jpg)
Western Blot: ASRGL1 Antibody [NBP2-38759] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate
![Immunohistochemistry: ASRGL1 Antibody [NBP2-38759] - Staining of human uterus, pre-menopause shows strong cytoplasmic and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6248_ASRGL1-Antibody-Immunohistochemistry-NBP2-38759-img0001.jpg)
Immunohistochemistry: ASRGL1 Antibody [NBP2-38759] - Staining of human uterus, pre-menopause shows strong cytoplasmic and nuclear positivity in glandular cells.