KPNA5 Antibody
| Name | KPNA5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38715 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KRRNVYLPRNDESMLESPIQDPDISSTVPIPEEEVVTTDMVQMIFSNNADQQLTATQK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KPNA5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KPNA5 |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: KPNA5 Antibody [NBP2-38715] - Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17951_KPNA5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38715-img0001.jpg)
![Immunohistochemistry: KPNA5 Antibody [NBP2-38715] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/17952_KPNA5%2520Antibody-Immunohistochemistry-NBP2-38715-img0002.jpg)