STING/TMEM173 Antibody
| Name | STING/TMEM173 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38389 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: YSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCQTLEDILADAPESQNNCR |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | STING/TMEM173 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TMEM173 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: STING/TMEM173 Antibody [NBP2-38389] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9480_STING-TMEM173-Antibody-Western-Blot-NBP2-38389-img0002.jpg)
Western Blot: STING/TMEM173 Antibody [NBP2-38389] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative Control. Lane 3: Overexpression lysate
![Immunohistochemistry-Paraffin: STING/TMEM173 Antibody [NBP2-38389] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/9481_STING-TMEM173-Antibody-Immunohistochemistry-Paraffin-NBP2-38389-img0003.jpg)
Immunohistochemistry-Paraffin: STING/TMEM173 Antibody [NBP2-38389] - Staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells.