ZNF259 Antibody

Name ZNF259 Antibody
Supplier Novus Biologicals
Catalog NBP2-38172
Prices $129.00, $419.00
Sizes 25 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications Simple Western ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: RYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQV
Purity/Format Immunogen affinity purified
Blocking Peptide ZNF259 Protein
Description Rabbit Polyclonal
Gene ZPR1
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.