SNX5 Antibody

Name SNX5 Antibody
Supplier Novus Biologicals
Catalog NBP2-38641
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: FFEQEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVEGRV
Purity/Format Immunogen affinity purified
Blocking Peptide SNX5 Protein
Description Rabbit Polyclonal
Gene SNX5
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.