PARD6A Antibody
| Name | PARD6A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38487 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: DLVIENRQPPSSNGLSQGPPCWDLHPGCRHPGTRSSLPSLDDQEQASSGWGSRIRGDGSGFS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PARD6A Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PARD6A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: PARD6A Antibody [NBP2-38487] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15541_PARD6A-Antibody-Western-Blot-NBP2-38487-img0002.jpg)
Western Blot: PARD6A Antibody [NBP2-38487] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
![Immunocytochemistry/Immunofluorescence: PARD6A Antibody [NBP2-38487] - Staining of human cell line MCF7 shows localization to actin filaments & cell junctions.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15542_PARD6A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38487-img0003.jpg)
Immunocytochemistry/Immunofluorescence: PARD6A Antibody [NBP2-38487] - Staining of human cell line MCF7 shows localization to actin filaments & cell junctions.
![Immunohistochemistry: PARD6A Antibody [NBP2-38487] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/15543_PARD6A-Antibody-Immunohistochemistry-NBP2-38487-img0001.jpg)
Immunohistochemistry: PARD6A Antibody [NBP2-38487] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.