RITA Antibody
| Name | RITA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38441 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: GGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEASKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RITA Protein |
| Description | Rabbit Polyclonal |
| Gene | RITA1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: RITA Antibody [NBP2-38441] - Staining of human rectum shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/20443_RITA%2520Antibody-Immunohistochemistry-NBP2-38441-img0002.jpg)
Immunohistochemistry: RITA Antibody [NBP2-38441] - Staining of human rectum shows strong cytoplasmic, membranous and nuclear positivity in glandular cells.