Regucalcin Antibody
| Name | Regucalcin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80850 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Regucalcin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RGN |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Regucalcin Antibody [NBP1-80850] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16266_Regucalcin-Antibody-Western-Blot-NBP1-80850-img0005.jpg)
Western Blot: Regucalcin Antibody [NBP1-80850] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
![Immunocytochemistry/Immunofluorescence: Regucalcin Antibody [NBP1-80850] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16267_Regucalcin%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80850-img0008.jpg)
Immunocytochemistry/Immunofluorescence: Regucalcin Antibody [NBP1-80850] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleus.
![Immunocytochemistry/Immunofluorescence: Regucalcin Antibody [NBP1-80850] - Staining of adrenal gland shows cytoplasmic, nuclear and membranous positivity in cortical cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16268_Regucalcin-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80850-img0007.jpg)
Immunocytochemistry/Immunofluorescence: Regucalcin Antibody [NBP1-80850] - Staining of adrenal gland shows cytoplasmic, nuclear and membranous positivity in cortical cells.