JHDM1D Antibody
| Name | JHDM1D Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81382 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LETLKELREDGFQPQTYLVQGVKALHTALKLWMKKELVSEHAFEIPDNVRPGHLIKELSKVIRAIEEENGKPVKSQGIPIVCPVSRSSNEA |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | JHDM1D Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | KDM7A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Immunocytochemistry/Immunofluorescence: JHDM1D Antibody [NBP1-81382] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24844_JHDM1D-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81382-img0005.jpg)
![Immunohistochemistry-Paraffin: JHDM1D Antibody [NBP1-81382] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/24845_JHDM1D-Antibody-Immunohistochemistry-Paraffin-NBP1-81382-img0002.jpg)