KCC1/SLC12A4 Antibody

Name KCC1/SLC12A4 Antibody
Supplier Novus Biologicals
Catalog NBP1-83067
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB ICC/IF IHC IHC-P
Species Reactivities Human
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:MPHFTVVPVDGPRRGDYDNLEGLSWVDYGERAELDDSDGHGNHRESSPFLSPLEASRGIDYYDRNL
Purity/Format Immunogen affinity purified
Blocking Peptide KCC1/SLC12A4 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene SLC12A4
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.