PTDSS1 Antibody
| Name | PTDSS1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83060 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AEHYGHREKTYSECEDGTYSPEISWHHRKGTKGSEDSPPKHAGNNESHSSRRRNRHSKSKVTNGVGKK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PTDSS1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | PTDSS1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PTDSS1 Antibody [NBP1-83060] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6412_PTDSS1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83060-img0006.jpg)
Immunocytochemistry/Immunofluorescence: PTDSS1 Antibody [NBP1-83060] - Immunofluorescent staining of human cell line A-431 shows localization to endoplasmic reticulum.
![Immunohistochemistry: PTDSS1 Antibody [NBP1-83060] - Staining of human kidney shows strong nuclear positivity in cells in renal tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/6413_PTDSS1-Antibody-Immunohistochemistry-NBP1-83060-img0003.jpg)
Immunohistochemistry: PTDSS1 Antibody [NBP1-83060] - Staining of human kidney shows strong nuclear positivity in cells in renal tubules.