DOCK2 Antibody
| Name | DOCK2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83023 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SFDLELASPKTPRVEQEEPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | DOCK2 Protein |
| Description | Rabbit Polyclonal |
| Gene | DOCK2 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: DOCK2 Antibody [NBP1-83023] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm. Antibody staining is shown in green.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19399_DOCK2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83023-img0002.jpg)
Immunocytochemistry/Immunofluorescence: DOCK2 Antibody [NBP1-83023] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane & cytoplasm. Antibody staining is shown in green.
![Immunohistochemistry: DOCK2 Antibody [NBP1-83023] - Staining of human vagina shows strong cytoplasmic positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19400_DOCK2-Antibody-Immunohistochemistry-NBP1-83023-img0004.jpg)
Immunohistochemistry: DOCK2 Antibody [NBP1-83023] - Staining of human vagina shows strong cytoplasmic positivity in squamous epithelial cells.