FNTA Antibody
| Name | FNTA Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83428 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | FNTA Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | FNTA |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: FNTA Antibody [NBP1-83428] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4994_FNTA-Antibody-Western-Blot-NBP1-83428-img0005.jpg)
Western Blot: FNTA Antibody [NBP1-83428] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
![Immunohistochemistry-Paraffin: FNTA Antibody [NBP1-83428] - Staining of human prostate shows nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/4995_FNTA-Antibody-Immunohistochemistry-Paraffin-NBP1-83428-img0002.jpg)
Immunohistochemistry-Paraffin: FNTA Antibody [NBP1-83428] - Staining of human prostate shows nuclear and cytoplasmic positivity in glandular cells.