DDX25 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-83329
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:KQVTIVVNFDLPVKQGEEPDYETYLHRIGRTGRFGKKGLAFNMIEVDELPSLMKIQDHFNSSIKQLNAEDMDEIE
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: DDX25 Protein
• Description: Rabbit Polyclonal
• Gene: DDX25

Product images

Immunohistochemistry-Paraffin: DDX25 Antibody [NBP1-83329] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Western Blot: DDX25 Antibody [NBP1-83329] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Western Blot: DDX25 Antibody [NBP1-83329] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue
Lane 6: Human tonsil tissue