MED18 Antibody
| Name | MED18 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83673 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGH |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MED18 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MED18 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MED18 Antibody [NBP1-83673] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19753_MED18%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83673-img0002.jpg)
Immunocytochemistry/Immunofluorescence: MED18 Antibody [NBP1-83673] - Staining of human cell line A-431 shows positivity in nuclei but not nucleoli.
![Immunohistochemistry-Paraffin: MED18 Antibody [NBP1-83673] - Immunohistochemical staining of human gall bladder shows moderate nuclear and cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/19754_MED18%2520Antibody-Immunohistochemistry-Paraffin-NBP1-83673-img0001.jpg)
Immunohistochemistry-Paraffin: MED18 Antibody [NBP1-83673] - Immunohistochemical staining of human gall bladder shows moderate nuclear and cytoplasmic positivity in glandular cells.