SRD5A3 Antibody
| Name | SRD5A3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82259 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:KCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SRD5A3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | SRD5A3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: SRD5A3 Antibody [NBP1-82259] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5197_SRD5A3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82259-img0004.jpg)
Immunocytochemistry/Immunofluorescence: SRD5A3 Antibody [NBP1-82259] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
![Immunohistochemistry-Paraffin: SRD5A3 Antibody [NBP1-82259] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5198_SRD5A3-Antibody-Immunohistochemistry-Paraffin-NBP1-82259-img0005.jpg)
Immunohistochemistry-Paraffin: SRD5A3 Antibody [NBP1-82259] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.