Sigma-1 R/OPRS1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-82479
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB Simple Western ICC/IF IHC IHC-P
• Species Reactivities: Human, Rat
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: Sigma-1 R/OPRS1 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SIGMAR1
• Conjugate: Unconjugated

Product images

Western Blot: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Analysis in human cell line HeLa.

Immunocytochemistry/Immunofluorescence: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Staining of human small intestine shows distinct positivity in glandular cells.

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Simple Western lane view shows a specific band for SIGMAR1 in 0.2 mg/ml of Liver (left), RT-4 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Electropherogram image(s) of corresponding Simple Western lane view. Sigma-1 R/OPRS1 antibody was used at 1:20 dilution on Liver lysate(s).

Simple Western: Sigma-1 R/OPRS1 Antibody [NBP1-82479] - Electropherogram image(s) of corresponding Simple Western lane view. Sigma-1 R/OPRS1 antibody was used at 1:20 dilution on RT-4 lysate(s).