GSG1 Antibody
| Name | GSG1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82714 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MSDPSQLTQNVCLTQEMELSKAFSGQRTLL |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | GSG1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | GSG1 |
| Supplier Page | Shop |
![Western Blot: GSG1 Antibody [NBP1-82714] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20198_GSG1%2520Antibody-Western%2520Blot-NBP1-82714-img0004.jpg)
![Immunohistochemistry-Paraffin: GSG1 Antibody [NBP1-82714] - Staining of human pancreas shows strong cytoplasmic positivity in subsets of islets of Langerhans.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20199_GSG1-Antibody-Immunohistochemistry-Paraffin-NBP1-82714-img0002.jpg)