GSG1 Recombinant Protein Antigen

Name GSG1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82714PEP
Category Protein
Prices $209.00
Sizes 100 µl
Applications B/N
For Antibody GSG1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene GSG1
Sequence MSDPSQLTQNVCLTQEMELSKAFSGQRTLL
Description A recombinant protein antigen corresponding to GSG1
Supplier Page Shop