MAT2B Antibody
| Name | MAT2B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82798 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVGAFLIYISSDYVFDGTNPPYREEDIPAPLNLYGKTKLDGEKAVLENNLGAAVLRIPILYGEVEKLEESAVTVM |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MAT2B Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MAT2B |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MAT2B Antibody [NBP1-82798] - Analysis in human cell line HepG2.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14916_MAT2B-Antibody-Western-Blot-NBP1-82798-img0005.jpg)
Western Blot: MAT2B Antibody [NBP1-82798] - Analysis in human cell line HepG2.
![Immunocytochemistry/Immunofluorescence: MAT2B Antibody [NBP1-82798] - Staining of human kidney shows moderate membranous positivity in cells in tubules and in glomeruli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14917_MAT2B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82798-img0006.jpg)
Immunocytochemistry/Immunofluorescence: MAT2B Antibody [NBP1-82798] - Staining of human kidney shows moderate membranous positivity in cells in tubules and in glomeruli.
![Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82798] - Staining of human kidney shows moderate cytoplasmic, membranous and nuclear positivity in tubule cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/14918_MAT2B-Antibody-Immunohistochemistry-Paraffin-NBP1-82798-img0002.jpg)
Immunohistochemistry-Paraffin: MAT2B Antibody [NBP1-82798] - Staining of human kidney shows moderate cytoplasmic, membranous and nuclear positivity in tubule cells.