PNPLA1 Antibody
| Name | PNPLA1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85172 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:SLSAFPAQPPVEELGQEQPQAVALLVSSKPKSAVPLVHVKETVSKPYVTESPAEDSNWVNKVFKKNKQKTSGTRKGFPRHSGSK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | PNPLA1 Protein |
| Description | Rabbit Polyclonal |
| Gene | PNPLA1 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: PNPLA1 Antibody [NBP1-85172] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (intermediate filaments).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20451_PNPLA1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85172-img0003.jpg)
Immunocytochemistry/Immunofluorescence: PNPLA1 Antibody [NBP1-85172] - Staining of human cell line U-2 OS shows positivity in cytoskeleton (intermediate filaments).
![Immunohistochemistry-Paraffin: PNPLA1 Antibody [NBP1-85172] - Staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20452_PNPLA1%2520Antibody-Immunohistochemistry-Paraffin-NBP1-85172-img0002.jpg)
Immunohistochemistry-Paraffin: PNPLA1 Antibody [NBP1-85172] - Staining of human duodenum shows moderate cytoplasmic and membranous positivity in glandular cells.