NLRP10/Pynod/NALP10 Antibody
| Name | NLRP10/Pynod/NALP10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85556 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:RARYFSSYFTDEKQADRAFDIVQKNDILYKACQVPGICWVVCSWLQGQMERGKVVLETPRNSTDIFMAYVSTFLPPDDDGGCSELSRHRV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | NLRP10/Pynod/NALP10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | NLRP10 |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: NLRP10/Pynod/NALP10 Antibody [NBP1-85556] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20639_NLRP10-Pynod-NALP10-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85556-img0005.jpg)
Immunocytochemistry/Immunofluorescence: NLRP10/Pynod/NALP10 Antibody [NBP1-85556] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
![Immunohistochemistry-Paraffin: NLRP10/Pynod/NALP10 Antibody [NBP1-85556] - Staining of human kidney shows strong cytoplasmic positivity in tubular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20640_NLRP10-Pynod-NALP10-Antibody-Immunohistochemistry-Paraffin-NBP1-85556-img0006.jpg)
Immunohistochemistry-Paraffin: NLRP10/Pynod/NALP10 Antibody [NBP1-85556] - Staining of human kidney shows strong cytoplasmic positivity in tubular cells.