EYA4 Antibody
| Name | EYA4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85546 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:QYAQYYSASTYGAYMTSNNTADGTPSSTSTYQLQESLPGLTNQPGEFDTMQSPSTPIKDLDERTCRSSGSKS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | EYA4 Protein |
| Description | Rabbit Polyclonal |
| Gene | EYA4 |
| Supplier Page | Shop |
Product images
![Western Blot: EYA4 Antibody [NBP1-85546] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/22802_EYA4-Antibody-Western-Blot-NBP1-85546-img0006.jpg)
Western Blot: EYA4 Antibody [NBP1-85546] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
![Immunocytochemistry/Immunofluorescence: EYA4 Antibody [NBP1-85546] - Immunofluorescent staining of human cell line A-431 shows positivity in centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/22803_EYA4-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85546-img0004.jpg)
Immunocytochemistry/Immunofluorescence: EYA4 Antibody [NBP1-85546] - Immunofluorescent staining of human cell line A-431 shows positivity in centrosome.
![Immunohistochemistry-Paraffin: EYA4 Antibody [NBP1-85546] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/22804_EYA4-Antibody-Immunohistochemistry-Paraffin-NBP1-85546-img0002.jpg)
Immunohistochemistry-Paraffin: EYA4 Antibody [NBP1-85546] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.