TRIM72 Antibody
| Name | TRIM72 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-86000 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGE |
| Description | Rabbit Polyclonal |
| Gene | TRIM72 |
| Supplier Page | Shop |
Product images
![Western Blot: TRIM72 Antibody [NBP1-86000] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20881_TRIM72%2520Antibody-Western%2520Blot-NBP1-86000-img0004.jpg)
Western Blot: TRIM72 Antibody [NBP1-86000] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
![Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP1-86000] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20882_TRIM72-Antibody-Immunohistochemistry-Paraffin-NBP1-86000-img0002.jpg)
Immunohistochemistry-Paraffin: TRIM72 Antibody [NBP1-86000] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.