SUCLA2 Antibody
| Name | SUCLA2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85860 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | SUCLA2 Protein |
| Description | Rabbit Polyclonal |
| Gene | SUCLA2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: SUCLA2 Antibody [NBP1-85860] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9416_SUCLA2-Antibody-Western-Blot-NBP1-85860-img0006.jpg)
Western Blot: SUCLA2 Antibody [NBP1-85860] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Mouse Cerebral Cortex tissue
![Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP1-85860] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9417_SUCLA2-Antibody-Immunohistochemistry-Paraffin-NBP1-85860-img0007.jpg)
Immunohistochemistry-Paraffin: SUCLA2 Antibody [NBP1-85860] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.
![Western Blot: SUCLA2 Antibody [NBP1-85860] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9418_SUCLA2-Antibody-Western-Blot-NBP1-85860-img0004.jpg)
Western Blot: SUCLA2 Antibody [NBP1-85860] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
![Western Blot: SUCLA2 Antibody [NBP1-85860] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/9419_SUCLA2-Antibody-Western-Blot-NBP1-85860-img0005.jpg)
Western Blot: SUCLA2 Antibody [NBP1-85860] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue