CPN1 Antibody
| Name | CPN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-85851 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:TSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEM |
| Description | Rabbit Polyclonal |
| Gene | CYP11B1 |
| Supplier Page | Shop |
Product images
![Western Blot: CPN1 Antibody [NBP1-85851] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20987_CPN1%2520Antibody-Western%2520Blot-NBP1-85851-img0004.jpg)
Western Blot: CPN1 Antibody [NBP1-85851] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
![Immunohistochemistry-Paraffin: CPN1 Antibody [NBP1-85851] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/20988_CPN1-Antibody-Immunohistochemistry-Paraffin-NBP1-85851-img0002.jpg)
Immunohistochemistry-Paraffin: CPN1 Antibody [NBP1-85851] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.