PDE6D Antibody

Name PDE6D Antibody
Supplier Novus Biologicals
Catalog NBP1-86275
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:KVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSRVRL
Purity/Format Immunogen affinity purified
Blocking Peptide PDE6D Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene PDE6D
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.