TOX3 Antibody

Name TOX3 Antibody
Supplier Novus Biologicals
Catalog NBP1-86676
Prices $129.00, $419.00
Sizes 25 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications Simple Western IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:SQGSEFTPQFPPQSLDLPSITISRNLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMP
Purity/Format Immunogen affinity purified
Blocking Peptide TOX3 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene TOX3
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.