SNRPD2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-87028
• Prices: $419.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC IHC-P
• Species Reactivities: Human
• Antigen: This antibody was developed against Recombinant Protein corresponding to amino acids:REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTE
• Purity/Format: Immunogen affinity purified
• Blocking Peptide: SNRPD2 Recombinant Protein Antigen
• Description: Rabbit Polyclonal
• Gene: SNRPD2

Product images

Immunohistochemistry-Paraffin: SNRPD2 Antibody [NBP1-87028] - Staining of human stomach shows strong nuclear positivity in glandular cells.

Western Blot: SNRPD2 Antibody [NBP1-87028] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)
Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)

Western Blot: SNRPD2 Antibody [NBP1-87028] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Human cell line RT-4
Lane 3: Human cell line U-251MG sp
Lane 4: Human plasma (IgG/HSA depleted)
Lane 5: Human liver tissue