RDH16 Antibody
| Name | RDH16 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-87117 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:GVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVT |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | RDH16 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | RDH16 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: RDH16 Antibody [NBP1-87117] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26782_RDH16%2520Antibody-Western%2520Blot-NBP1-87117-img0005.jpg)
![Immunohistochemistry-Paraffin: RDH16 Antibody [NBP1-87117] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/26783_RDH16-Antibody-Immunohistochemistry-Paraffin-NBP1-87117-img0002.jpg)