HSD17B8 Antibody

Name HSD17B8 Antibody
Supplier Novus Biologicals
Catalog NBP1-84309
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against Recombinant Protein corresponding to amino acids:GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGY
Purity/Format Immunogen affinity purified
Blocking Peptide HSD17B8 Recombinant Protein Antigen
Description Rabbit Polyclonal
Gene HSD17B8
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.