MLC1 Antibody
| Name | MLC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81555 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MLC1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | MLC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/16842_MLC1-Antibody-Immunohistochemistry-Paraffin-NBP1-81555-img0004.jpg)
Immunohistochemistry-Paraffin: MLC1 Antibody [NBP1-81555] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.