IQSEC1 Antibody
| Name | IQSEC1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81480 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:PSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IQSEC1 Protein |
| Description | Rabbit Polyclonal |
| Gene | IQSEC1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: IQSEC1 Antibody [NBP1-81480] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & vesicles.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5282_IQSEC1%2520Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81480-img0004.jpg)
Immunocytochemistry/Immunofluorescence: IQSEC1 Antibody [NBP1-81480] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoli & vesicles.
![Immunohistochemistry-Paraffin: IQSEC1 Antibody [NBP1-81480] - Staining of human skin shows strong cytoplasmic positivity in basal cells of squamous epithelium.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/5283_IQSEC1-Antibody-Immunohistochemistry-Paraffin-NBP1-81480-img0002.jpg)
Immunohistochemistry-Paraffin: IQSEC1 Antibody [NBP1-81480] - Staining of human skin shows strong cytoplasmic positivity in basal cells of squamous epithelium.