C8orf41/TTI2 Antibody
| Name | C8orf41/TTI2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-82086 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:LLGKVETAKNSLVGPAWQTGLHHLAGPVYIFAITHSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | C8orf41/TTI2 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | TTI2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C8orf41/TTI2 Antibody [NBP1-82086] - Analysis in control (vector only transfected HEK293T lysate) and TTI2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410894).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17292_C8orf41-TTI2%2520Antibody-Western%2520Blot-NBP1-82086-img0006.jpg)
Western Blot: C8orf41/TTI2 Antibody [NBP1-82086] - Analysis in control (vector only transfected HEK293T lysate) and TTI2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410894).
![Immunocytochemistry/Immunofluorescence: C8orf41/TTI2 Antibody [NBP1-82086] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli, cytoplasm and centrosome.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17293_C8orf41-TTI2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82086-img0005.jpg)
Immunocytochemistry/Immunofluorescence: C8orf41/TTI2 Antibody [NBP1-82086] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli, cytoplasm and centrosome.
![Immunohistochemistry-Paraffin: C8orf41/TTI2 Antibody [NBP1-82086] - Staining of human smooth muscle shows strong cytoplasmic positivity.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/17294_C8orf41-TTI2-Antibody-Immunohistochemistry-Paraffin-NBP1-82086-img0002.jpg)
Immunohistochemistry-Paraffin: C8orf41/TTI2 Antibody [NBP1-82086] - Staining of human smooth muscle shows strong cytoplasmic positivity.